PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF090300050CFD_t1
Common NameTRAES_3BF090300050CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 204aa    MW: 22194.8 Da    PI: 9.9036
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF090300050CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.17.9e-3897152459
                   zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                              + l+cprC s++tkfCy+nny+++qPr+fCkaC+ryWt+GGalrnvP+G+grrkn+
  TRAES3BF090300050CFD_t1  97 APLPCPRCRSRETKFCYFNNYNVNQPRHFCKACHRYWTAGGALRNVPIGAGRRKNR 152
                              5689**************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027016.3E-3199152IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.55699153IPR003851Zinc finger, Dof-type
PROSITE patternPS013610101137IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-20108152IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MLSHVEMAPA GAGGGFKLFG KVITQCVEGT QASPSPSPVF AAQDEERRLH GETDRTTTAV  60
KREAADMDSS QQQQQQGAEA SRRTQLQESA EARAAAAPLP CPRCRSRETK FCYFNNYNVN  120
QPRHFCKACH RYWTAGGALR NVPIGAGRRK NRPLGPIATV AGHHHHHHRA AAGFVLGFPS  180
PSSSPTSPPP VYADRWQLGP DGRF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567133.13e-70PREDICTED: cyclic dof factor 4
SwissprotO229672e-34CDF4_ARATH; Cyclic dof factor 4
TrEMBLA0A077RU981e-151A0A077RU98_WHEAT; Uncharacterized protein
STRINGBRADI2G50370.11e-69(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64952851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.12e-29Dof family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]